(data stored in ACNUC10821 zone)

EMBL: AE017262.PE422

AE017262.PE422       Location/Qualifiers
FT   CDS             444201..444623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0429; match
FT                   to protein family HMM PF07009"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03212"
FT                   /protein_id="AAT03212.1"
FT                   /translation="MRQYMKMVRPFDFVIIILLILGSFLPLILFSVAEAKHVGDDVVAV
FT                   ISQDGKVVREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWK
FT                   SKAGDTIVCLPHKVFVEIKSTNKKSKDPDTDLIVPN"
     MRQYMKMVRP FDFVIIILLI LGSFLPLILF SVAEAKHVGD DVVAVISQDG KVVREIPLTG        60
     HKGNEQFTIK GKGAQYNLME VDGERIRIKE DNSPDQVGVK MGWKSKAGDT IVCLPHKVFV       120
     EIKSTNKKSK DPDTDLIVPN                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page