(data stored in ACNUC10821 zone)

EMBL: AE017262.PE425

AE017262.PE425       Location/Qualifiers
FT   CDS             complement(450173..451051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0431"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03215"
FT                   /protein_id="AAT03215.1"
FT                   /translation="MYMTGLGTLLFLVGIGVLIFGLVSFRRKNWPRKKTQIIIISSILA
FT                   IIIGVGIIPTTDEEASTEEPTKQEEKTEKVDNTPILKAETTFTTDDEGTLVVEGKTNPG
FT                   AEVTLDFVAIPDAVTTADENGAFSLSVNQLDKAQDAVLSIVIDGQTKEQTLKLALTPAY
FT                   ETKLTAKAEAERVAAEKAEAERVERERVAAEEKRAADAKIAAEKKAEEARVAAEKKAAE
FT                   EKRVAAERSKAAAAQPDTSNEQGQMVYITATGKRYHYDQNCRGLNNSNGETAVTVAQAK
FT                   AQGLTLCKFEQ"
     MYMTGLGTLL FLVGIGVLIF GLVSFRRKNW PRKKTQIIII SSILAIIIGV GIIPTTDEEA        60
     STEEPTKQEE KTEKVDNTPI LKAETTFTTD DEGTLVVEGK TNPGAEVTLD FVAIPDAVTT       120
     ADENGAFSLS VNQLDKAQDA VLSIVIDGQT KEQTLKLALT PAYETKLTAK AEAERVAAEK       180
     AEAERVERER VAAEEKRAAD AKIAAEKKAE EARVAAEKKA AEEKRVAAER SKAAAAQPDT       240
     SNEQGQMVYI TATGKRYHYD QNCRGLNNSN GETAVTVAQA KAQGLTLCKF EQ               292
//

If you have problems or comments...

PBIL Back to PBIL home page