(data stored in ACNUC10821 zone)

EMBL: AE017262.PE432

AE017262.PE432       Location/Qualifiers
FT   CDS             complement(455283..455837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LL0877; match
FT                   to protein family HMM PF06736"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03222"
FT                   /protein_id="AAT03222.1"
FT                   /translation="MSKGRLEAFSDGVFAIIITIIVLGMTLPDVFTAASTQAFLWEIFI
FT                   FIEGGLIIGQFWYSHSRLFDQVTFISTSAVLFNILFLLVLSLIPLFTRAIMQHPDMTAP
FT                   IIGFVITILITSVLFQLLHHAVNGKDSGIDNWKFRISSFIFVIMLGIISFFAPQISTIL
FT                   FIIFPIAGWIIQLTNRRQPPK"
     MSKGRLEAFS DGVFAIIITI IVLGMTLPDV FTAASTQAFL WEIFIFIEGG LIIGQFWYSH        60
     SRLFDQVTFI STSAVLFNIL FLLVLSLIPL FTRAIMQHPD MTAPIIGFVI TILITSVLFQ       120
     LLHHAVNGKD SGIDNWKFRI SSFIFVIMLG IISFFAPQIS TILFIIFPIA GWIIQLTNRR       180
     QPPK                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page