(data stored in ACNUC10821 zone)

EMBL: AE017262.PE433

AE017262.PE433       Location/Qualifiers
FT   CDS             455984..456796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0439"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03223"
FT                   /protein_id="AAT03223.1"
FT                   /translation="MIRAISVDMDGTFLDGNGEYDRARFEKIYVELMKRGIKFIVASGN
FT                   QYYQLKSFFPGKDEELFYVAENGAVIFHQGELRSVNRFEERLVQKILRTLIQEYQDLQV
FT                   ILCGVKSAYLLKAADPDFKAFAKKYYFESQELDSFDVLPDDTFIKFALDVEVAKTGQIV
FT                   EDLNQMFAGEIRAVSSGHGSIDIIIPGVTKGSAIQQLLNEWQVAPDDLLAFGDANNDIE
FT                   MLQLTSHSYAMQESSPEVLAAAKHVAASNKEAGVLQVIEEYMKKSQRP"
     MIRAISVDMD GTFLDGNGEY DRARFEKIYV ELMKRGIKFI VASGNQYYQL KSFFPGKDEE        60
     LFYVAENGAV IFHQGELRSV NRFEERLVQK ILRTLIQEYQ DLQVILCGVK SAYLLKAADP       120
     DFKAFAKKYY FESQELDSFD VLPDDTFIKF ALDVEVAKTG QIVEDLNQMF AGEIRAVSSG       180
     HGSIDIIIPG VTKGSAIQQL LNEWQVAPDD LLAFGDANND IEMLQLTSHS YAMQESSPEV       240
     LAAAKHVAAS NKEAGVLQVI EEYMKKSQRP                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page