(data stored in ACNUC10821 zone)

EMBL: AE017262.PE436

AE017262.PE436       Location/Qualifiers
FT   CDS             459796..460260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0442"
FT                   /product="PTS system, fructose-specific, IIA component"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM TIGR00848"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03226"
FT                   /protein_id="AAT03226.1"
FT                   /translation="MEVKDILTKELVVFDLEATTKEAAIEEMAEMLDEHGILADKATYV
FT                   RAVLDREAHSTTGIGNNIAIPHGKSESVTKSAIVFARTKEMIEWESLDDEPVNMIFLLA
FT                   ITDSDKTDGHLKILAEIATKLMDDDIVENLKNTRDEEEVIRILNGGVVEI"
     MEVKDILTKE LVVFDLEATT KEAAIEEMAE MLDEHGILAD KATYVRAVLD REAHSTTGIG        60
     NNIAIPHGKS ESVTKSAIVF ARTKEMIEWE SLDDEPVNMI FLLAITDSDK TDGHLKILAE       120
     IATKLMDDDI VENLKNTRDE EEVIRILNGG VVEI                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page