(data stored in ACNUC10821 zone)

EMBL: AE017262.PE437

AE017262.PE437       Location/Qualifiers
FT   CDS             460257..460577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0443"
FT                   /product="PTS system, fructose-specific, IIB component"
FT                   /note="identified by match to protein family HMM PF02379;
FT                   match to protein family HMM TIGR00829"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03227"
FT                   /protein_id="AAT03227.1"
FT                   /translation="MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATG
FT                   IENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAALALID
FT                   EK"
     MKRKIIAVTA CATGVAHTYM AAQALKKGAK KMGNLIKVET QGATGIENEL TEKDVNIGEV        60
     VIFAVDTKVR NKERFDGKVV LEVPVSAPIK DAEKVINAAL ALIDEK                      106
//

If you have problems or comments...

PBIL Back to PBIL home page