(data stored in ACNUC10821 zone)

EMBL: AE017262.PE44

AE017262.PE44        Location/Qualifiers
FT   CDS             47989..49374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0046"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02834"
FT                   /protein_id="AAT02834.1"
FT                   /translation="MEKKKKFRLFDAVLMAVCVVLVVESAAPAAAIGSSQFFWWIALLI
FT                   LFFLPYGLVSAELGTTYDDEGGIYDWVKRAFGRKWGARVAWLYWINYPIWMASLAVLFV
FT                   EVITQIFPVSFGTPVSIFIQLIFVWIVVIISCYPVSDSKWILNIAAFCKVAIMLCLGVL
FT                   GIYFAMTKGLANDFSGKALLPTFDLESLSFISVILFNFLGFEVVTTLASDMENPKKQIP
FT                   QAIIYGGVLIAFFYLLAAFGMGAAIPTSELSTSGGLIDSFIMLIGGVNPFVIIIGIMFM
FT                   YTLVANLVSWALGVNYVAMYAAKNKDLPAVFGKTNPKNDMPTGTSILNGIVASVLIVAA
FT                   PLIPNENIFWAFFALNVVALLGSYILMFPAFLKLRKVDPDRERPFKVPGGKILLYLMTF
FT                   VPMILLIITLIFSAVPLNGSSAELNEKIPILIGTVVAVIVGEICIWLAGKRKDKGEIGN
FT                   END"
     MEKKKKFRLF DAVLMAVCVV LVVESAAPAA AIGSSQFFWW IALLILFFLP YGLVSAELGT        60
     TYDDEGGIYD WVKRAFGRKW GARVAWLYWI NYPIWMASLA VLFVEVITQI FPVSFGTPVS       120
     IFIQLIFVWI VVIISCYPVS DSKWILNIAA FCKVAIMLCL GVLGIYFAMT KGLANDFSGK       180
     ALLPTFDLES LSFISVILFN FLGFEVVTTL ASDMENPKKQ IPQAIIYGGV LIAFFYLLAA       240
     FGMGAAIPTS ELSTSGGLID SFIMLIGGVN PFVIIIGIMF MYTLVANLVS WALGVNYVAM       300
     YAAKNKDLPA VFGKTNPKND MPTGTSILNG IVASVLIVAA PLIPNENIFW AFFALNVVAL       360
     LGSYILMFPA FLKLRKVDPD RERPFKVPGG KILLYLMTFV PMILLIITLI FSAVPLNGSS       420
     AELNEKIPIL IGTVVAVIVG EICIWLAGKR KDKGEIGNEN D                           461
//

If you have problems or comments...

PBIL Back to PBIL home page