(data stored in ACNUC10821 zone)

EMBL: AE017262.PE444

AE017262.PE444       Location/Qualifiers
FT   CDS             467516..474103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0450"
FT                   /product="putative wall-associated protein"
FT                   /note="identified by similarity to SP:Q07833; match to
FT                   protein family HMM PF02018; match to protein family HMM
FT                   PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03234"
FT                   /protein_id="AAT03234.1"
FT                   /translation="MKIHAKAKKILVSLIAIMLFLSLIPGYAPMAEETSTGVEVPEKKA
FT                   GEQAPTEVKEERTENEVVFNNHDGSFTKQIFADSINMEVDGEMKRIDANVEKEADSDMI
FT                   VPKQTPLELGFLDKMEDGAYQKLTKAGAEVTFRLKGARTGENEQAVTDQPATYKENEVT
FT                   YENVFPKTDLRHLTFPQSVKEDIVLHEPNQVDTYVYQIETKLGLELAKNGDVLFKNKSG
FT                   ETMYTLPKPVMTDSNVGAETGEAALSENVSFEVKQLTKTVYELQLKVDTAWLNDVAREY
FT                   PVYIDPSVRLDEVYNANINSAKPTETNIGSKLWDSGQNAYTLKLGKWDNSTGNNAAYLK
FT                   MDTSTLNKATISKATLKVYNIWHMSPTVKNDLWYYESNANWSPWQVTWNTAPATTRIGS
FT                   VNVGRGEWANLDVTKTVQAWASGVRPNNGFRLATNIDQNYWKKLVASENNKNYPYLEVN
FT                   YTYAQPEKPTVKTNSNGVGTGTGYMDLSWKAVPGATSYNIVISNGYNYEYINTKSTATT
FT                   WSTKGKKISPTNDEIANGEFEFHHDGKGTEFALDPRAQYENAFQAGSTFGLRNLTRYLF
FT                   RVQAVFPGGESPNSDLVFAYMPIEKPQPPAAKAYSNLAHKETGYVELNWEKSPMADGYK
FT                   VLVFNGKAYEEYDVGAETKWTTQNKGIWPTKEEIAEGKFALHHDGKGDELAKDPSPVYT
FT                   NSGGNYKERTNYWFRIVAYQKAGNNATSIQSEPATPSLPEVVNKQLGMVDYWTSVPVRG
FT                   GEVNATNGNFLFHETDFNLEGRGPSINVDRTFNSQDDATGIFGKGWTSTLEEKLIEEEN
FT                   GNIVWVESDKKVHRFTKKGDKYVAPPGIYSEITKNADGYLKIEEDKSETRFLADGRLKS
FT                   EKDTKGNELTYEYTDGKLTNMRDASGRTVTLAYEGELVKELVGPEDRKISYTYNDKQEL
FT                   ISSSTARGKIYCYGYTDGLLTSIYDPKHTEEKPYETTFAYEEEKLTEITDPVGKKTTLS
FT                   YDMEEQQTTLTNEKKKKTIYSYNDAGNPKKEIVDADGLKLTTTYTYESNNLVKEVNPKG
FT                   QEETYSYDADGNITQATDAYGTESYTYNGNNDVTSATDTEGRKTTVTYDGADAVSETLA
FT                   TESQVSSVTQYDAYGNPIRGSGELSSAGNLLQNSGFEKGAGVSNWTLIQSDAKGSMTFD
FT                   STQSAPGTLGGSGSVKLTSEANSTVKGYSSVTQRVDVEPETTYTFSAWIKTSGMTNADA
FT                   LLIGRLQDANAKDITDAGVWQSNRATSIKKNGDWVKRQLTFKTSKNTRQVLLYLDNEQP
FT                   APHKGKGTIWYDNVQFEKGSVASSYNPVVNSSFEEHNGTLPTGWMRTGNTALTQAKVVD
FT                   NESHSGDSAVYFERKATSEAYTHIVQDVPVNQKEAKALTISALSKSEDAKANGSVATMS
FT                   NDYSIWGTIYYQDGTTSSVQGQFPLGTNDWNRSAVVVKPTKPVKMIKVYTMFRNGLTGK
FT                   AWFDDVRVIEGEVLTKNEYDASGNYVTASYDEEGRKISFTYDIYGNTTSETDEKGNKKT
FT                   LTYDADNALIDTKLANGTSVAYKYDDNGNTTEKNVTASGKTQKNIYEYDVDNKITAFTD
FT                   ALNRTIKYEYDAAGNETKAIMPNGRVTESTYDSADRLDGIKWNDKLAFKFQYDPNGNQT
FT                   KVTDEINSIVTDKTYDDANRITKVAERGGDVSYTYKDKPTKDNKGKTDKVGEVAINHGD
FT                   YTAKTSYTYNDLDRNTRVNDGSKNAYFEFDEFGNINVYTAGNGTAANYTYDSTQKVTNA
FT                   AISSASGTQILDENYTYDAASNRTSIDNKQDGKTTYEYDAVNQLTKETLPDGTVKAYTY
FT                   DGFGNRTQVAISGSETKTIAASYNDGNQLVSWNGEALTYDANGNRTSDGKYTYTWDTGD
FT                   RLSSITKKGESKPFTSYTYDDDNRRLSKTVDGVTTNYHYDGDSIDVLYETDGDGKVVRQ
FT                   YVYSDDNVRLAMKMNGKTLYYHYNAHGDVIALTDEAGKIVAEYAYDAWGNVLKNTASTE
FT                   EAKANPYGYAGYTYDKEIEQYYLMARYYEPEQGVFTAYDPDPGDEDDPQTMNGYNYANN
FT                   NPVMMVDPDGNWAWLIPAAMAAGKFIYKFRKPIAKYGKKGAKWVGKTAKKGAKWVGKTA
FT                   KKGAKWARSRYNSKKKEFTVTKNWKVGLPKKSQGGRIFAIINRKKGRLFALDYGKVGGN
FT                   QKKYLHVHWNYKPKHYIIYPRKGRGK"
     MKIHAKAKKI LVSLIAIMLF LSLIPGYAPM AEETSTGVEV PEKKAGEQAP TEVKEERTEN        60
     EVVFNNHDGS FTKQIFADSI NMEVDGEMKR IDANVEKEAD SDMIVPKQTP LELGFLDKME       120
     DGAYQKLTKA GAEVTFRLKG ARTGENEQAV TDQPATYKEN EVTYENVFPK TDLRHLTFPQ       180
     SVKEDIVLHE PNQVDTYVYQ IETKLGLELA KNGDVLFKNK SGETMYTLPK PVMTDSNVGA       240
     ETGEAALSEN VSFEVKQLTK TVYELQLKVD TAWLNDVARE YPVYIDPSVR LDEVYNANIN       300
     SAKPTETNIG SKLWDSGQNA YTLKLGKWDN STGNNAAYLK MDTSTLNKAT ISKATLKVYN       360
     IWHMSPTVKN DLWYYESNAN WSPWQVTWNT APATTRIGSV NVGRGEWANL DVTKTVQAWA       420
     SGVRPNNGFR LATNIDQNYW KKLVASENNK NYPYLEVNYT YAQPEKPTVK TNSNGVGTGT       480
     GYMDLSWKAV PGATSYNIVI SNGYNYEYIN TKSTATTWST KGKKISPTND EIANGEFEFH       540
     HDGKGTEFAL DPRAQYENAF QAGSTFGLRN LTRYLFRVQA VFPGGESPNS DLVFAYMPIE       600
     KPQPPAAKAY SNLAHKETGY VELNWEKSPM ADGYKVLVFN GKAYEEYDVG AETKWTTQNK       660
     GIWPTKEEIA EGKFALHHDG KGDELAKDPS PVYTNSGGNY KERTNYWFRI VAYQKAGNNA       720
     TSIQSEPATP SLPEVVNKQL GMVDYWTSVP VRGGEVNATN GNFLFHETDF NLEGRGPSIN       780
     VDRTFNSQDD ATGIFGKGWT STLEEKLIEE ENGNIVWVES DKKVHRFTKK GDKYVAPPGI       840
     YSEITKNADG YLKIEEDKSE TRFLADGRLK SEKDTKGNEL TYEYTDGKLT NMRDASGRTV       900
     TLAYEGELVK ELVGPEDRKI SYTYNDKQEL ISSSTARGKI YCYGYTDGLL TSIYDPKHTE       960
     EKPYETTFAY EEEKLTEITD PVGKKTTLSY DMEEQQTTLT NEKKKKTIYS YNDAGNPKKE      1020
     IVDADGLKLT TTYTYESNNL VKEVNPKGQE ETYSYDADGN ITQATDAYGT ESYTYNGNND      1080
     VTSATDTEGR KTTVTYDGAD AVSETLATES QVSSVTQYDA YGNPIRGSGE LSSAGNLLQN      1140
     SGFEKGAGVS NWTLIQSDAK GSMTFDSTQS APGTLGGSGS VKLTSEANST VKGYSSVTQR      1200
     VDVEPETTYT FSAWIKTSGM TNADALLIGR LQDANAKDIT DAGVWQSNRA TSIKKNGDWV      1260
     KRQLTFKTSK NTRQVLLYLD NEQPAPHKGK GTIWYDNVQF EKGSVASSYN PVVNSSFEEH      1320
     NGTLPTGWMR TGNTALTQAK VVDNESHSGD SAVYFERKAT SEAYTHIVQD VPVNQKEAKA      1380
     LTISALSKSE DAKANGSVAT MSNDYSIWGT IYYQDGTTSS VQGQFPLGTN DWNRSAVVVK      1440
     PTKPVKMIKV YTMFRNGLTG KAWFDDVRVI EGEVLTKNEY DASGNYVTAS YDEEGRKISF      1500
     TYDIYGNTTS ETDEKGNKKT LTYDADNALI DTKLANGTSV AYKYDDNGNT TEKNVTASGK      1560
     TQKNIYEYDV DNKITAFTDA LNRTIKYEYD AAGNETKAIM PNGRVTESTY DSADRLDGIK      1620
     WNDKLAFKFQ YDPNGNQTKV TDEINSIVTD KTYDDANRIT KVAERGGDVS YTYKDKPTKD      1680
     NKGKTDKVGE VAINHGDYTA KTSYTYNDLD RNTRVNDGSK NAYFEFDEFG NINVYTAGNG      1740
     TAANYTYDST QKVTNAAISS ASGTQILDEN YTYDAASNRT SIDNKQDGKT TYEYDAVNQL      1800
     TKETLPDGTV KAYTYDGFGN RTQVAISGSE TKTIAASYND GNQLVSWNGE ALTYDANGNR      1860
     TSDGKYTYTW DTGDRLSSIT KKGESKPFTS YTYDDDNRRL SKTVDGVTTN YHYDGDSIDV      1920
     LYETDGDGKV VRQYVYSDDN VRLAMKMNGK TLYYHYNAHG DVIALTDEAG KIVAEYAYDA      1980
     WGNVLKNTAS TEEAKANPYG YAGYTYDKEI EQYYLMARYY EPEQGVFTAY DPDPGDEDDP      2040
     QTMNGYNYAN NNPVMMVDPD GNWAWLIPAA MAAGKFIYKF RKPIAKYGKK GAKWVGKTAK      2100
     KGAKWVGKTA KKGAKWARSR YNSKKKEFTV TKNWKVGLPK KSQGGRIFAI INRKKGRLFA      2160
     LDYGKVGGNQ KKYLHVHWNY KPKHYIIYPR KGRGK                                 2195
//

If you have problems or comments...

PBIL Back to PBIL home page