(data stored in ACNUC10821 zone)

EMBL: AE017262.PE445

AE017262.PE445       Location/Qualifiers
FT   CDS             474103..474585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03235"
FT                   /protein_id="AAT03235.1"
FT                   /translation="MLDKQQLYIVENKDIPNYEVDSGITGAEQNYIYNFKNPIPISEQE
FT                   LQDICDTFGEFMVSAYFLVDIFGPYEELPGDKKNGYKKVVLADESMEIKKKMFHLFLEG
FT                   DAYPDANKIFLFKEKKELNARKNMEIEDGMIVISPVLDVTAIGIFSKGIDLAQFFK"
     MLDKQQLYIV ENKDIPNYEV DSGITGAEQN YIYNFKNPIP ISEQELQDIC DTFGEFMVSA        60
     YFLVDIFGPY EELPGDKKNG YKKVVLADES MEIKKKMFHL FLEGDAYPDA NKIFLFKEKK       120
     ELNARKNMEI EDGMIVISPV LDVTAIGIFS KGIDLAQFFK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page