(data stored in ACNUC10821 zone)

EMBL: AE017262.PE447

AE017262.PE447       Location/Qualifiers
FT   CDS             475465..475815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03237"
FT                   /protein_id="AAT03237.1"
FT                   /translation="MYNASPSVGHLGMKSTIDRKKRSDLTFPLKPKRFLNIFKSEPMRE
FT                   KPGIMEYNKFIIVTKGVDIKTLLSGVSDLNRRENIEYFLVQNTIMTYQILEGEVINFYA
FT                   KDLGFLVDELAL"
     MYNASPSVGH LGMKSTIDRK KRSDLTFPLK PKRFLNIFKS EPMREKPGIM EYNKFIIVTK        60
     GVDIKTLLSG VSDLNRRENI EYFLVQNTIM TYQILEGEVI NFYAKDLGFL VDELAL           116
//

If you have problems or comments...

PBIL Back to PBIL home page