(data stored in ACNUC10821 zone)

EMBL: AE017262.PE455

AE017262.PE455       Location/Qualifiers
FT   CDS             479199..479693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0461"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03245"
FT                   /protein_id="AAT03245.1"
FT                   /translation="MSKIIEKTIFTLTNQEQIIITNNDEMSDDALKTTIINKSQPMHLL
FT                   LELGIFDKEDLTEKFPSSEIIEILYERTKLLLIKDIQLDSVHLDEVLFIFRLLANSNFL
FT                   VHIISGYKIDNILHYSQKDTIFKRNKVVGKFELHLDKDEFLIMSDYDGSSVIILSNEQK
FT                   C"
     MSKIIEKTIF TLTNQEQIII TNNDEMSDDA LKTTIINKSQ PMHLLLELGI FDKEDLTEKF        60
     PSSEIIEILY ERTKLLLIKD IQLDSVHLDE VLFIFRLLAN SNFLVHIISG YKIDNILHYS       120
     QKDTIFKRNK VVGKFELHLD KDEFLIMSDY DGSSVIILSN EQKC                        164
//

If you have problems or comments...

PBIL Back to PBIL home page