(data stored in ACNUC10821 zone)

EMBL: AE017262.PE457

AE017262.PE457       Location/Qualifiers
FT   CDS             480288..481076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0463"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03247"
FT                   /protein_id="AAT03247.1"
FT                   /translation="MLKIKKQAQSIYAFKETGGEVLNFQIEKNCLKLFSGEEILCEIND
FT                   EIISNRYFRINKVILSDEKICIFCHGEACDYLFILCMGKNFKYILREGVEDFLVINDEA
FT                   YVIYSEEGMFSDEGNLSIAKLGLIKIDIFTGEITGLLDDTILETLIDVQSISCNNKTIR
FT                   ILCYEDNGDDFTLDYDLTSKKVRNKVVINYTVDGLVSVGDNFYACYRNRIYKVNESMEI
FT                   TEEIIIDKKVYDEAYAISTGYSEVVLESENEFNIVQLSKL"
     MLKIKKQAQS IYAFKETGGE VLNFQIEKNC LKLFSGEEIL CEINDEIISN RYFRINKVIL        60
     SDEKICIFCH GEACDYLFIL CMGKNFKYIL REGVEDFLVI NDEAYVIYSE EGMFSDEGNL       120
     SIAKLGLIKI DIFTGEITGL LDDTILETLI DVQSISCNNK TIRILCYEDN GDDFTLDYDL       180
     TSKKVRNKVV INYTVDGLVS VGDNFYACYR NRIYKVNESM EITEEIIIDK KVYDEAYAIS       240
     TGYSEVVLES ENEFNIVQLS KL                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page