(data stored in ACNUC10821 zone)

EMBL: AE017262.PE458

AE017262.PE458       Location/Qualifiers
FT   CDS             481229..481894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0464"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03248"
FT                   /protein_id="AAT03248.1"
FT                   /translation="MKKLNYFSIGFDYDEEKNPIMSFDSQSHCISEMYSGAFKPMMTKE
FT                   TSCIDINCIPTGKKVDKSHHLDAIYRVYFENKLFDLNKFNDENDSEKKKIILELLHIGA
FT                   IEACRNLGLDKARFIEAYEKVKELDYQNNYYYKKPKSSPNRKQKAQIYIEHGLYKADIY
FT                   IVIFNKEQKIIRKEFILSDLPNPFVFSAHLGNLKWIDNDRLVLAHKQRKDILYKVDMI"
     MKKLNYFSIG FDYDEEKNPI MSFDSQSHCI SEMYSGAFKP MMTKETSCID INCIPTGKKV        60
     DKSHHLDAIY RVYFENKLFD LNKFNDENDS EKKKIILELL HIGAIEACRN LGLDKARFIE       120
     AYEKVKELDY QNNYYYKKPK SSPNRKQKAQ IYIEHGLYKA DIYIVIFNKE QKIIRKEFIL       180
     SDLPNPFVFS AHLGNLKWID NDRLVLAHKQ RKDILYKVDM I                           221
//

If you have problems or comments...

PBIL Back to PBIL home page