(data stored in ACNUC10821 zone)

EMBL: AE017262.PE460

AE017262.PE460       Location/Qualifiers
FT   CDS             482394..482981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0466"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03250"
FT                   /protein_id="AAT03250.1"
FT                   /translation="MINLEWKELDQLEIEEKVQEVLDYSYNTWMSDKKNIRYFVRAFYI
FT                   KWDMIAYMYGMEENETEDDKLKSMFDFGISELRNITEVDWIMGYCMLINPIFFEENDNY
FT                   LELEEKGQEMLRNVAINNPDDVFLTSFGIPEKDYLKWKRANREQLIQYGEDNFNFDSEF
FT                   SRYFKHIINCRADEEVEKESFLKKIVRKWKQR"
     MINLEWKELD QLEIEEKVQE VLDYSYNTWM SDKKNIRYFV RAFYIKWDMI AYMYGMEENE        60
     TEDDKLKSMF DFGISELRNI TEVDWIMGYC MLINPIFFEE NDNYLELEEK GQEMLRNVAI       120
     NNPDDVFLTS FGIPEKDYLK WKRANREQLI QYGEDNFNFD SEFSRYFKHI INCRADEEVE       180
     KESFLKKIVR KWKQR                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page