(data stored in ACNUC10821 zone)

EMBL: AE017262.PE467

AE017262.PE467       Location/Qualifiers
FT   CDS             489490..490335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0474"
FT                   /product="putative ytfG protein"
FT                   /note="identified by similarity to SP:P39315"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03257"
FT                   /protein_id="AAT03257.1"
FT                   /translation="MTYLVTGATGGLGGYALNYLKELVPMSDIYALVRSEEKGADLKAA
FT                   GFNIRVGDYSDAESMKQAFVGIDRVLFVSGAPGNRQVEHENVVNAAKAAGVSYIAYTSF
FT                   AGADKSTSALAEDHFFTEKVIEKSGIAHTFLRNNWYFENEMPMIGGALSAGKFVYAAEN
FT                   GKVGWALKREYAEVAAKAVAGADFPEILELSGPLMTYEELTKALKEATGKDFDVISSDD
FT                   KGFVENLVSAGLPQPVAEMFLSFQHDIKNDQLDVTSDDFEKALGKPLTNRVDALRELLK
FT                   "
     MTYLVTGATG GLGGYALNYL KELVPMSDIY ALVRSEEKGA DLKAAGFNIR VGDYSDAESM        60
     KQAFVGIDRV LFVSGAPGNR QVEHENVVNA AKAAGVSYIA YTSFAGADKS TSALAEDHFF       120
     TEKVIEKSGI AHTFLRNNWY FENEMPMIGG ALSAGKFVYA AENGKVGWAL KREYAEVAAK       180
     AVAGADFPEI LELSGPLMTY EELTKALKEA TGKDFDVISS DDKGFVENLV SAGLPQPVAE       240
     MFLSFQHDIK NDQLDVTSDD FEKALGKPLT NRVDALRELL K                           281
//

If you have problems or comments...

PBIL Back to PBIL home page