(data stored in ACNUC10821 zone)

EMBL: AE017262.PE469

AE017262.PE469       Location/Qualifiers
FT   CDS             complement(491141..492409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0457; match
FT                   to protein family HMM PF00668"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03259"
FT                   /protein_id="AAT03259.1"
FT                   /translation="MVKITSYPAEPSDVKHYISGEKMKNDHHLHTVLTFDNHLNIDVLK
FT                   KAVMQSTKKLPLLLCHFKETKKGAFWQESVFSAEDLVFLVETQAPETEVDRALVTKLST
FT                   ENGPQICFTVVRADTSDQLVVIMNHMLADGAGFKEYLYLLSELYSNLLENPDYAANLSL
FT                   GSRSLKQIFDQFSRKDIKSIFTEKTKQKAVHNPTFPLKGDPKNPKFIWTKLPKEDFSEI
FT                   IHFAKEHEATVNDVLFAAMARTVQQTTGQQEMSIDCPVDLRKYLPSKTSSGITNLTANI
FT                   TCQISANDDLTSFESTLQAVKNSLNPQKNSFAPLRIYYLLELIFKKKNYSVAKKASEKM
FT                   YSIPKTSFTNIGIIDEEKLVFEGSTLTDCFICGSLKYAPFFQVAATTFRGELTLSTNLH
FT                   GTTQDHAWQKDFLEQMISEFPSK"
     MVKITSYPAE PSDVKHYISG EKMKNDHHLH TVLTFDNHLN IDVLKKAVMQ STKKLPLLLC        60
     HFKETKKGAF WQESVFSAED LVFLVETQAP ETEVDRALVT KLSTENGPQI CFTVVRADTS       120
     DQLVVIMNHM LADGAGFKEY LYLLSELYSN LLENPDYAAN LSLGSRSLKQ IFDQFSRKDI       180
     KSIFTEKTKQ KAVHNPTFPL KGDPKNPKFI WTKLPKEDFS EIIHFAKEHE ATVNDVLFAA       240
     MARTVQQTTG QQEMSIDCPV DLRKYLPSKT SSGITNLTAN ITCQISANDD LTSFESTLQA       300
     VKNSLNPQKN SFAPLRIYYL LELIFKKKNY SVAKKASEKM YSIPKTSFTN IGIIDEEKLV       360
     FEGSTLTDCF ICGSLKYAPF FQVAATTFRG ELTLSTNLHG TTQDHAWQKD FLEQMISEFP       420
     SK                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page