(data stored in ACNUC10821 zone)

EMBL: AE017262.PE47

AE017262.PE47        Location/Qualifiers
FT   CDS             51510..52619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:EF0734; match to
FT                   protein family HMM PF04371"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02837"
FT                   /db_xref="GOA:Q725C4"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725C4"
FT                   /protein_id="AAT02837.1"
FT                   /translation="MGQLKGLPVEDGFRMPGEYEPHIGCFMIWPERPDNWRLGGKPAQQ
FT                   NYKEVAVAISNFEPVTMFVSPNQYKNARKELPDTIRVIEMSNDDAWIRDYGPSFLVNDK
FT                   GEMRGVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCDLERLDYYSQKDFILEGCSIHVDG
FT                   EGTLVTTEECLLSEGRNPNLTKIEIEQTLKKYFHVQKVIWLKHGFYLDETNGHVDNIFN
FT                   FVAPGEVVLSWTDNKSDPQYEISRECYDILANQTDAKGRTFMIHKLHCPDPVLITQTES
FT                   EGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFDDPKDKDAQELLEQLYPDRKIV
FT                   GIKAREILLGGGNIHCITQHLPDKSTIRE"
     MGQLKGLPVE DGFRMPGEYE PHIGCFMIWP ERPDNWRLGG KPAQQNYKEV AVAISNFEPV        60
     TMFVSPNQYK NARKELPDTI RVIEMSNDDA WIRDYGPSFL VNDKGEMRGV DWGFNAWGGL       120
     LDGLYFPWDK DNQIAKKVCD LERLDYYSQK DFILEGCSIH VDGEGTLVTT EECLLSEGRN       180
     PNLTKIEIEQ TLKKYFHVQK VIWLKHGFYL DETNGHVDNI FNFVAPGEVV LSWTDNKSDP       240
     QYEISRECYD ILANQTDAKG RTFMIHKLHC PDPVLITQTE SEGVEAINGT FPRQAGDRLA       300
     ASYVNYYTAN GAIIFPLFDD PKDKDAQELL EQLYPDRKIV GIKAREILLG GGNIHCITQH       360
     LPDKSTIRE                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page