(data stored in ACNUC10821 zone)

EMBL: AE017262.PE471

AE017262.PE471       Location/Qualifiers
FT   CDS             complement(493092..495128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0478"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM PF05223"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03261"
FT                   /protein_id="AAT03261.1"
FT                   /translation="MASYGGKKRNNKKAIIIGSIAAVAVLAGIAIYFFIQNQHKDEKNA
FT                   LAAAETFTSNIAKEKYDKLGSSVSSESLKKVEFTKKEMEDKYQAVYDGIGAKDIKVKNL
FT                   KSVYDDKENKFNLTYELEMRTSLGKLATQKYKTTISKQDDDWKIDWKPALIFPGMVKTD
FT                   KVRITEDEAERGQIVDRNGNPLATTGQFAEAGVVPSKLGEGDEKVKNIADISKKLEVST
FT                   DYINKQLDQKWVQADSFVPLVTLNKDNLPEATGLTYAQKEMRTYPLNEATSHLIGYVGE
FT                   VSAEDIEKNPKLSVGDVIGKSGLERYYDKQLRGKNGGAIKIINDQTKQEDTLQKIDKKD
FT                   GEEIKLTIDAAVQKKAFDSLGSETGAVTMINPTNGELLALVSTPSYDANQMVLGITSED
FT                   YAKYNDDKRLPFLARYANRYAPGSTFKTITATIGLDTGVTKPDKVREISGLQWQKDASW
FT                   GKYFVTRVHDVPKVNMTDALVHSDNIYFAQEGLEIGKDKLTAGLKKFDFDKEYNLPFTM
FT                   KPAQISNDGLNSEILLADTSYGQGELLMSPIQQAIAYSAIASDGKMPYPKLDTKEKAGK
FT                   ETQATEAASANQVKAALVKTVSDPAGTAHALQIQGHSIAAKTGTAELKEKQGEDGLENG
FT                   FVYAFDADNPNYLMVGMIENVKGRGGSGLVIDKLKPVIESMYK"
     MASYGGKKRN NKKAIIIGSI AAVAVLAGIA IYFFIQNQHK DEKNALAAAE TFTSNIAKEK        60
     YDKLGSSVSS ESLKKVEFTK KEMEDKYQAV YDGIGAKDIK VKNLKSVYDD KENKFNLTYE       120
     LEMRTSLGKL ATQKYKTTIS KQDDDWKIDW KPALIFPGMV KTDKVRITED EAERGQIVDR       180
     NGNPLATTGQ FAEAGVVPSK LGEGDEKVKN IADISKKLEV STDYINKQLD QKWVQADSFV       240
     PLVTLNKDNL PEATGLTYAQ KEMRTYPLNE ATSHLIGYVG EVSAEDIEKN PKLSVGDVIG       300
     KSGLERYYDK QLRGKNGGAI KIINDQTKQE DTLQKIDKKD GEEIKLTIDA AVQKKAFDSL       360
     GSETGAVTMI NPTNGELLAL VSTPSYDANQ MVLGITSEDY AKYNDDKRLP FLARYANRYA       420
     PGSTFKTITA TIGLDTGVTK PDKVREISGL QWQKDASWGK YFVTRVHDVP KVNMTDALVH       480
     SDNIYFAQEG LEIGKDKLTA GLKKFDFDKE YNLPFTMKPA QISNDGLNSE ILLADTSYGQ       540
     GELLMSPIQQ AIAYSAIASD GKMPYPKLDT KEKAGKETQA TEAASANQVK AALVKTVSDP       600
     AGTAHALQIQ GHSIAAKTGT AELKEKQGED GLENGFVYAF DADNPNYLMV GMIENVKGRG       660
     GSGLVIDKLK PVIESMYK                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page