(data stored in ACNUC10821 zone)

EMBL: AE017262.PE474

AE017262.PE474       Location/Qualifiers
FT   CDS             complement(496728..497276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0481"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GP:5578868"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03264"
FT                   /protein_id="AAT03264.1"
FT                   /translation="MKKVSSLLTQDQFWGIIDNSDKGSKLEELLEKLSEDELFGYDYWW
FT                   NYFHKKSYNQSLWAVAYVVLGGCSDDGFDYFRYWLITRGKAVFTSAVENADTLCGEFDL
FT                   LTEDEYPENEEVAYLVMDIFENKLGKDFDDAENEAESRIEFEEVSMPPIDFEWDEDDED
FT                   SIKKVCPNTFAKWWNNDKF"
     MKKVSSLLTQ DQFWGIIDNS DKGSKLEELL EKLSEDELFG YDYWWNYFHK KSYNQSLWAV        60
     AYVVLGGCSD DGFDYFRYWL ITRGKAVFTS AVENADTLCG EFDLLTEDEY PENEEVAYLV       120
     MDIFENKLGK DFDDAENEAE SRIEFEEVSM PPIDFEWDED DEDSIKKVCP NTFAKWWNND       180
     KF                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page