(data stored in ACNUC10821 zone)

EMBL: AE017262.PE48

AE017262.PE48        Location/Qualifiers
FT   CDS             52636..53415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0050"
FT                   /product="phosphosugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02838"
FT                   /protein_id="AAT02838.1"
FT                   /translation="MDFFEISSKTVASLTRNERILFDYVVKNMNLIKNQSIREVSAECF
FT                   VSTTTFLRFVRKLGFTGYSEFTTVLKFTLLGHTELKPSPFVVEQSDYREEYLKNIIESV
FT                   RVLEPSKIKKITKKLVSKPRIYFFAKGLSKHAAKYIKYLYTMSGFLVEFPEDYQYRQAV
FT                   LPHIGKDDLVFILTYGGHDIELIQTAQKLKSRNETPMLISITGADNNIIQNMSDINLYI
FT                   FTDEIEMNNLDITSRISTIAIMELILYQFMEDETSSF"
     MDFFEISSKT VASLTRNERI LFDYVVKNMN LIKNQSIREV SAECFVSTTT FLRFVRKLGF        60
     TGYSEFTTVL KFTLLGHTEL KPSPFVVEQS DYREEYLKNI IESVRVLEPS KIKKITKKLV       120
     SKPRIYFFAK GLSKHAAKYI KYLYTMSGFL VEFPEDYQYR QAVLPHIGKD DLVFILTYGG       180
     HDIELIQTAQ KLKSRNETPM LISITGADNN IIQNMSDINL YIFTDEIEMN NLDITSRIST       240
     IAIMELILYQ FMEDETSSF                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page