(data stored in ACNUC10821 zone)

EMBL: AE017262.PE481

AE017262.PE481       Location/Qualifiers
FT   CDS             504261..505844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412913; match to
FT                   protein family HMM PF07905"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03271"
FT                   /protein_id="AAT03271.1"
FT                   /translation="MADLMKLPSLKEAKVVSGKSGLSKLVSSISVLEYTEVALLEDDLF
FT                   DNDEFYGSEIVVSAFVNIRDDVEAQCRTIERLHKVGEVALILYYVGIFVPKMDQKLIDF
FT                   ANELDFTIIVMPENEMSLRYSEVIYEVVEAIVKQEMTDTNFVTESLEQISSVRPPQRNI
FT                   DTTLKILSDRTHTSLVLTDNSFQVINSITWPRTRHWDFERIIEASKQIGEHELVQLTLD
FT                   ERDFYTARKPIFQDGMQAMHLFMMKEKGVLTADVVMQITEVVQVFMNLWGRNYVEISTA
FT                   ELMKAILNDESVKMRRLGKILNVDVSSIKWMWLVKTEEIRDNEQVLAELKSFVASHFQV
FT                   SLIDLFEDNIVVLLDNSVAQRDRTHTANEFAMMMKEHGIDLKITVCQGMEQTSDVQSAY
FT                   SLVNEYKNAANAIYANKSIYSLQEIDFAAKCVEIVDRGELAIAEQMRPLKPLEDNDELI
FT                   ETLSVFLLEGESNYNQAAELLFLHKNTIKYRIQRINELLQYPATKIPESYNLYLAVAIR
FT                   RILGGNNNNK"
     MADLMKLPSL KEAKVVSGKS GLSKLVSSIS VLEYTEVALL EDDLFDNDEF YGSEIVVSAF        60
     VNIRDDVEAQ CRTIERLHKV GEVALILYYV GIFVPKMDQK LIDFANELDF TIIVMPENEM       120
     SLRYSEVIYE VVEAIVKQEM TDTNFVTESL EQISSVRPPQ RNIDTTLKIL SDRTHTSLVL       180
     TDNSFQVINS ITWPRTRHWD FERIIEASKQ IGEHELVQLT LDERDFYTAR KPIFQDGMQA       240
     MHLFMMKEKG VLTADVVMQI TEVVQVFMNL WGRNYVEIST AELMKAILND ESVKMRRLGK       300
     ILNVDVSSIK WMWLVKTEEI RDNEQVLAEL KSFVASHFQV SLIDLFEDNI VVLLDNSVAQ       360
     RDRTHTANEF AMMMKEHGID LKITVCQGME QTSDVQSAYS LVNEYKNAAN AIYANKSIYS       420
     LQEIDFAAKC VEIVDRGELA IAEQMRPLKP LEDNDELIET LSVFLLEGES NYNQAAELLF       480
     LHKNTIKYRI QRINELLQYP ATKIPESYNL YLAVAIRRIL GGNNNNK                     527
//

If you have problems or comments...

PBIL Back to PBIL home page