(data stored in ACNUC10821 zone)

EMBL: AE017262.PE482

AE017262.PE482       Location/Qualifiers
FT   CDS             505978..507261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0489"
FT                   /product="cytosine/purines/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /note="identified by match to protein family HMM PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03272"
FT                   /protein_id="AAT03272.1"
FT                   /translation="MTEKKSVEQTQSWQSLAFVWTGAMICVPSLLVGGTLISGMPLWEA
FT                   ILIALLGYGVIVLFMIYQGMQSSDLGIPAVSVASQVFGEQGSKKIISILLAIACLGWFG
FT                   IQANVCGAAFSQFLGIYGINLPVPVSSLIWGVIMLLSAIYGIRILSILNYIAVPVLLFV
FT                   CIYGLVVSLNDGGLAIVENYKPAGSMSFMTGLAITIGSFALGAVIAGDYSQYTKSRKDV
FT                   VKAAIVGILPSGVLMITVGAVLALTAGTADISVVFTNLGLPVLGIIGLILAAWTTNAVN
FT                   AFSGGIAIINVFNISEKYHKVAVAVAGGLGTILAVIGILNHFVPIMSVLSAMVPPVAGV
FT                   MIASYWIVQKGDKSKWAPVSGVNWLGVSSWLVGAVIAGIPVILTFFPELPQLPNQPLIG
FT                   IILSLAVYLIGAKVLSGKTNNVENLEGK"
     MTEKKSVEQT QSWQSLAFVW TGAMICVPSL LVGGTLISGM PLWEAILIAL LGYGVIVLFM        60
     IYQGMQSSDL GIPAVSVASQ VFGEQGSKKI ISILLAIACL GWFGIQANVC GAAFSQFLGI       120
     YGINLPVPVS SLIWGVIMLL SAIYGIRILS ILNYIAVPVL LFVCIYGLVV SLNDGGLAIV       180
     ENYKPAGSMS FMTGLAITIG SFALGAVIAG DYSQYTKSRK DVVKAAIVGI LPSGVLMITV       240
     GAVLALTAGT ADISVVFTNL GLPVLGIIGL ILAAWTTNAV NAFSGGIAII NVFNISEKYH       300
     KVAVAVAGGL GTILAVIGIL NHFVPIMSVL SAMVPPVAGV MIASYWIVQK GDKSKWAPVS       360
     GVNWLGVSSW LVGAVIAGIP VILTFFPELP QLPNQPLIGI ILSLAVYLIG AKVLSGKTNN       420
     VENLEGK                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page