(data stored in ACNUC10821 zone)

EMBL: AE017262.PE483

AE017262.PE483       Location/Qualifiers
FT   CDS             507262..508362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0471; match
FT                   to protein family HMM PF06032"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03273"
FT                   /protein_id="AAT03273.1"
FT                   /translation="MRYLDEQAIENIAIGAAFLGTGGGGDPYIGKMMALTAIKKHGPIK
FT                   LLSPEEIADDDYFIPAAMMGAPSVLIEKFPKGDEFVRVFEKLGRYVGKEVKGTFPMEAG
FT                   GVNSMIPIVVAAQLGLPMVDCDGMGRAFPELQMVTFHLDGISATPMAITDEKGNIGIME
FT                   TIDNKWTERLARVTTVEMGASSLVSLYPCNGAQIKQSSIKNIVTLSEEIGKVIRETSMD
FT                   EAEKLQKLLDVTHGYHLFEGKITDVVRETRAGFNFGRVKIDGLNKDTGSEVIVHFQNEN
FT                   LVAEKNGEPIAITPDLICMVDLETLMPVTTEALKYGKRVRVMALPADDAWRTDKGIETV
FT                   GPRYFGYDVDFEPLEELVKKEERRHV"
     MRYLDEQAIE NIAIGAAFLG TGGGGDPYIG KMMALTAIKK HGPIKLLSPE EIADDDYFIP        60
     AAMMGAPSVL IEKFPKGDEF VRVFEKLGRY VGKEVKGTFP MEAGGVNSMI PIVVAAQLGL       120
     PMVDCDGMGR AFPELQMVTF HLDGISATPM AITDEKGNIG IMETIDNKWT ERLARVTTVE       180
     MGASSLVSLY PCNGAQIKQS SIKNIVTLSE EIGKVIRETS MDEAEKLQKL LDVTHGYHLF       240
     EGKITDVVRE TRAGFNFGRV KIDGLNKDTG SEVIVHFQNE NLVAEKNGEP IAITPDLICM       300
     VDLETLMPVT TEALKYGKRV RVMALPADDA WRTDKGIETV GPRYFGYDVD FEPLEELVKK       360
     EERRHV                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page