(data stored in ACNUC10821 zone)

EMBL: AE017262.PE488

AE017262.PE488       Location/Qualifiers
FT   CDS             514631..516700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0495"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM TIGR02167;
FT                   match to protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03278"
FT                   /protein_id="AAT03278.1"
FT                   /translation="MKKLSIRVILIVTIIFIACGSANVSIAQERDIINKLPEVELGSLY
FT                   TSNLITEEVAQDKPAEVENLEQAPTTDDLVQNPDVLEQPIADSDDSDLTVVNSGDFWTI
FT                   YRNTVNGEYSLHMFGNVPSSKPTAWNSYLNRIKHIEIEEATLTGNFSSYFRNNVFTVLE
FT                   SVRIERSNLSRVTSFALAFYGSGIEKVIIRDNNYPTAPSLLTTEGMFKNCSNLMEVDLS
FT                   GLDTSAVTTMWDMFNSCRALEELDVSHFDTSSVTNMSYMFYDNRNLEVLDVSNLDTGSV
FT                   TNMYAMFEDCTSLEELDVSNFDTSSVTDMYRVFNGCEKLKKLDVSNFDTSSATAMVQMF
FT                   RNCSALEKLDVSNFNTSLVTDMRAMFAGCTSLEALDVSNFDTSSVTNMAAMFSDNEKLE
FT                   KLDLSTFDTSSVTNMGTMFKNCTALKSLFLDNFTHAASSTDMFTGTTSLSYLFVSHNVS
FT                   NFNGLENTNWYDEKNWVQFSNLSQLQTYHRKQSEPTGYRKGAFLSLTMDAMGGEFEDAK
FT                   EQKVQSKISGEYWEEVIPVKEGHYFDGWYLDQNFTNKFDFSLPAAVSTTIYAKWVENYT
FT                   VVIPASISLNEASELKVEGINRGSKTLSVGLNYEETTISESNKLTLANTADTTVQCLAP
FT                   LSWDGSETNPEKAILTLAPGSEITEGDAVMAIEAPENIQAGKYTGNVVFSIKYE"
     MKKLSIRVIL IVTIIFIACG SANVSIAQER DIINKLPEVE LGSLYTSNLI TEEVAQDKPA        60
     EVENLEQAPT TDDLVQNPDV LEQPIADSDD SDLTVVNSGD FWTIYRNTVN GEYSLHMFGN       120
     VPSSKPTAWN SYLNRIKHIE IEEATLTGNF SSYFRNNVFT VLESVRIERS NLSRVTSFAL       180
     AFYGSGIEKV IIRDNNYPTA PSLLTTEGMF KNCSNLMEVD LSGLDTSAVT TMWDMFNSCR       240
     ALEELDVSHF DTSSVTNMSY MFYDNRNLEV LDVSNLDTGS VTNMYAMFED CTSLEELDVS       300
     NFDTSSVTDM YRVFNGCEKL KKLDVSNFDT SSATAMVQMF RNCSALEKLD VSNFNTSLVT       360
     DMRAMFAGCT SLEALDVSNF DTSSVTNMAA MFSDNEKLEK LDLSTFDTSS VTNMGTMFKN       420
     CTALKSLFLD NFTHAASSTD MFTGTTSLSY LFVSHNVSNF NGLENTNWYD EKNWVQFSNL       480
     SQLQTYHRKQ SEPTGYRKGA FLSLTMDAMG GEFEDAKEQK VQSKISGEYW EEVIPVKEGH       540
     YFDGWYLDQN FTNKFDFSLP AAVSTTIYAK WVENYTVVIP ASISLNEASE LKVEGINRGS       600
     KTLSVGLNYE ETTISESNKL TLANTADTTV QCLAPLSWDG SETNPEKAIL TLAPGSEITE       660
     GDAVMAIEAP ENIQAGKYTG NVVFSIKYE                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page