(data stored in ACNUC10821 zone)

EMBL: AE017262.PE489

AE017262.PE489       Location/Qualifiers
FT   CDS             516766..517239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03279"
FT                   /protein_id="AAT03279.1"
FT                   /translation="MKKKRVVIISLLLLLVSVIGISSYFLFKDKINLLDVDHSAVDWNG
FT                   KKQKDTSGEENTIAIPGFEKVTLYANETKQAVNFHNPEINDCYFKISLIHPDGSVLWIS
FT                   DLIEPGKGMYSIELEKTLAVGEYENAVLKYECFSLNDQSPLNGSEINLKLVVV"
     MKKKRVVIIS LLLLLVSVIG ISSYFLFKDK INLLDVDHSA VDWNGKKQKD TSGEENTIAI        60
     PGFEKVTLYA NETKQAVNFH NPEINDCYFK ISLIHPDGSV LWISDLIEPG KGMYSIELEK       120
     TLAVGEYENA VLKYECFSLN DQSPLNGSEI NLKLVVV                                157
//

If you have problems or comments...

PBIL Back to PBIL home page