(data stored in ACNUC10821 zone)

EMBL: AE017262.PE491

AE017262.PE491       Location/Qualifiers
FT   CDS             517796..518077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0498"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03281"
FT                   /protein_id="AAT03281.1"
FT                   /translation="MVLISFCGMFFLSPDRVQASQTVVEVLISEDDLDVSEENIQEIPK
FT                   KELAASSDKDNKQPILPKAGDTVTNYTLLGLVLVLIWLIMQRKRKKKE"
     MVLISFCGMF FLSPDRVQAS QTVVEVLISE DDLDVSEENI QEIPKKELAA SSDKDNKQPI        60
     LPKAGDTVTN YTLLGLVLVL IWLIMQRKRK KKE                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page