(data stored in ACNUC10821 zone)

EMBL: AE017262.PE495

AE017262.PE495       Location/Qualifiers
FT   CDS             520080..520424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03285"
FT                   /protein_id="AAT03285.1"
FT                   /translation="MQKDTYSGIRLSVIQLIDSKKENLKENNIKLTIIKDEKDGYVVEL
FT                   DNDKCMAEIVVEEPTYAPYRYISFEVVSLMDGKVKIIYSWYDDETSQWSDIEKELNKGI
FT                   QFLNNFKTME"
     MQKDTYSGIR LSVIQLIDSK KENLKENNIK LTIIKDEKDG YVVELDNDKC MAEIVVEEPT        60
     YAPYRYISFE VVSLMDGKVK IIYSWYDDET SQWSDIEKEL NKGIQFLNNF KTME             114
//

If you have problems or comments...

PBIL Back to PBIL home page