(data stored in ACNUC10821 zone)

EMBL: AE017262.PE496

AE017262.PE496       Location/Qualifiers
FT   CDS             520831..521073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI1685"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03286"
FT                   /protein_id="AAT03286.1"
FT                   /translation="MKRIILTSTLIVWTIVCIYMSISMVSNNTGIAFPIWLHIILLICF
FT                   LATGIVNVKKKEYLWSTMLFEGVLVVLLSLIIVLV"
     MKRIILTSTL IVWTIVCIYM SISMVSNNTG IAFPIWLHII LLICFLATGI VNVKKKEYLW        60
     STMLFEGVLV VLLSLIIVLV                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page