(data stored in ACNUC10821 zone)

EMBL: AE017262.PE498

AE017262.PE498       Location/Qualifiers
FT   CDS             522237..522572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0505"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0472"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03288"
FT                   /protein_id="AAT03288.1"
FT                   /translation="MAEDAIDKMKTNSSGVRLVLVGSGSVIILDEISGVAKNFRDKNGP
FT                   VANAIGASISQIKRDEALQDAEQKAREQPTLAGSVTDSIEVVEEIPLVHHLANAPRLRM
FT                   KVVGNLV"
     MAEDAIDKMK TNSSGVRLVL VGSGSVIILD EISGVAKNFR DKNGPVANAI GASISQIKRD        60
     EALQDAEQKA REQPTLAGSV TDSIEVVEEI PLVHHLANAP RLRMKVVGNL V                111
//

If you have problems or comments...

PBIL Back to PBIL home page