(data stored in ACNUC10821 zone)

EMBL: AE017262.PE500

AE017262.PE500       Location/Qualifiers
FT   CDS             523644..524204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0478"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03290"
FT                   /protein_id="AAT03290.1"
FT                   /translation="MAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYY
FT                   HFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASIL
FT                   SFCFSKLTNSLFMDLFEKIDTNGAVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPET
FT                   IANQLFRLAKDTEFLANSMYREN"
     MAESLITKKA IAGGLMELCQ HKRFEKISIA DITNICGLNR QTFYYHFTDK YDLLTWTYEN        60
     DFFHCLADGI TLGNWDKHVL KMLESIKENA DFYKNTVSAD ASILSFCFSK LTNSLFMDLF       120
     EKIDTNGAVN EADRVFYAEF FSYGCSGVLI KWITRGFKEA PETIANQLFR LAKDTEFLAN       180
     SMYREN                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page