(data stored in ACNUC10821 zone)

EMBL: AE017262.PE503

AE017262.PE503       Location/Qualifiers
FT   CDS             527358..527837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0481; match
FT                   to protein family HMM PF06445"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03293"
FT                   /protein_id="AAT03293.1"
FT                   /translation="MEVEIVERNAFTAVGKKRTFSVENDAQKEKISQFWQEANTNGDAE
FT                   RINELAEFATIDGILGVCKMNGDKMDYYIAIESELTPPADMEKLIIPASKWAIFKSVGP
FT                   LPSAIQKVWEYIYGEWFQTSNYAHGNAPELEVYTEGDTTAADYYSEVWIPVVEKE"
     MEVEIVERNA FTAVGKKRTF SVENDAQKEK ISQFWQEANT NGDAERINEL AEFATIDGIL        60
     GVCKMNGDKM DYYIAIESEL TPPADMEKLI IPASKWAIFK SVGPLPSAIQ KVWEYIYGEW       120
     FQTSNYAHGN APELEVYTEG DTTAADYYSE VWIPVVEKE                              159
//

If you have problems or comments...

PBIL Back to PBIL home page