(data stored in ACNUC10821 zone)

EMBL: AE017262.PE504

AE017262.PE504       Location/Qualifiers
FT   CDS             527995..528360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01BH3296; match
FT                   to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03294"
FT                   /db_xref="GOA:Q723G7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR023953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723G7"
FT                   /protein_id="AAT03294.1"
FT                   /translation="MIIVTNTIKVEKGAAEHVIRQFTGANGDGHPTKDIAEVEGFLGFE
FT                   LWHSKPEDKDYEEVVVTSKWESEEAQRNWVKSDSFKKAHGRTKDTREQREDRKGIVGNA
FT                   IARFEVVHVQNPVIVEK"
     MIIVTNTIKV EKGAAEHVIR QFTGANGDGH PTKDIAEVEG FLGFELWHSK PEDKDYEEVV        60
     VTSKWESEEA QRNWVKSDSF KKAHGRTKDT REQREDRKGI VGNAIARFEV VHVQNPVIVE       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page