(data stored in ACNUC10821 zone)

EMBL: AE017262.PE505

AE017262.PE505       Location/Qualifiers
FT   CDS             528853..530154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412606"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03295"
FT                   /protein_id="AAT03295.1"
FT                   /translation="MSRIDIGEIQDFAFQLRAANQTGRKIIQGVKTTVTNYVEDGSLKG
FT                   KAVEASKNYFQMTYIPLCDTIIEAMNESEERLKRYIQDFHDQVDLSPNAKIDADGLYEL
FT                   GQMIDRIESKKEALYQRMNSSTEGQMQTYRSQLATAYKQENILEKYLAFEQSHGAFFDH
FT                   LTDLVQGIQQTVRELQSNIQFNSQTGSYDLSKLNFATVNRMRKTLGKASATDTTVYNFA
FT                   SYSKVKQGVMWILSKDGKVDIKATEAYNTASFNGELPKESNQATEEGELLKATLESLKQ
FT                   NKDPITGQEISKAQSFGILTSLVFGYTTKGYQGKKLTISKNTLIKLRQADKTVIERIKK
FT                   TSRIDYEEIVKKGSKMPKHIIVENKQSLPGKAMPSSSADLLNPDGSVKQRRYYDEKGRA
FT                   KEDIDFNHSDDGTHEFPHRHEWDWDRKPPRKPSK"
     MSRIDIGEIQ DFAFQLRAAN QTGRKIIQGV KTTVTNYVED GSLKGKAVEA SKNYFQMTYI        60
     PLCDTIIEAM NESEERLKRY IQDFHDQVDL SPNAKIDADG LYELGQMIDR IESKKEALYQ       120
     RMNSSTEGQM QTYRSQLATA YKQENILEKY LAFEQSHGAF FDHLTDLVQG IQQTVRELQS       180
     NIQFNSQTGS YDLSKLNFAT VNRMRKTLGK ASATDTTVYN FASYSKVKQG VMWILSKDGK       240
     VDIKATEAYN TASFNGELPK ESNQATEEGE LLKATLESLK QNKDPITGQE ISKAQSFGIL       300
     TSLVFGYTTK GYQGKKLTIS KNTLIKLRQA DKTVIERIKK TSRIDYEEIV KKGSKMPKHI       360
     IVENKQSLPG KAMPSSSADL LNPDGSVKQR RYYDEKGRAK EDIDFNHSDD GTHEFPHRHE       420
     WDWDRKPPRK PSK                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page