(data stored in ACNUC10821 zone)

EMBL: AE017262.PE506

AE017262.PE506       Location/Qualifiers
FT   CDS             530167..530544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03296"
FT                   /protein_id="AAT03296.1"
FT                   /translation="MKNTVHDSEILSYHADFENSQLIMFVKDEENRKYKVIFEGLLTFC
FT                   FEHQMSNSIILDIVKGEVSSFISEKSILLSEGKNYFWPLDYESEDELLNYLNEKKLNYY
FT                   ELQASYGLNGWILCSHYHIEL"
     MKNTVHDSEI LSYHADFENS QLIMFVKDEE NRKYKVIFEG LLTFCFEHQM SNSIILDIVK        60
     GEVSSFISEK SILLSEGKNY FWPLDYESED ELLNYLNEKK LNYYELQASY GLNGWILCSH       120
     YHIEL                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page