(data stored in ACNUC10821 zone)

EMBL: AE017262.PE507

AE017262.PE507       Location/Qualifiers
FT   CDS             530778..531353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LM0480; match
FT                   to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03297"
FT                   /protein_id="AAT03297.1"
FT                   /translation="MIEKTIMERRSIKKANDAPISRETVNTILEQAAYAPFHSKVEPWN
FT                   VYVLHTLAEKERYIEKIIEFNEREQGVSFSEAEIADLKAGYAKKIITPPYLLIVTTNII
FT                   GHGKKDFESIGATSAFIQNIQLLGWEAGIGMIWRSNRFIFDAKFAEDLGIPSEQKIVGT
FT                   LHLTSLAEVPEAKPRRPLNEWVKNLADL"
     MIEKTIMERR SIKKANDAPI SRETVNTILE QAAYAPFHSK VEPWNVYVLH TLAEKERYIE        60
     KIIEFNEREQ GVSFSEAEIA DLKAGYAKKI ITPPYLLIVT TNIIGHGKKD FESIGATSAF       120
     IQNIQLLGWE AGIGMIWRSN RFIFDAKFAE DLGIPSEQKI VGTLHLTSLA EVPEAKPRRP       180
     LNEWVKNLAD L                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page