(data stored in ACNUC10821 zone)

EMBL: AE017262.PE511

AE017262.PE511       Location/Qualifiers
FT   CDS             533536..535530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0519"
FT                   /product="NADH:flavin oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00724; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03301"
FT                   /protein_id="AAT03301.1"
FT                   /translation="MTDYPSIFEPLTVKRMTIKNRVIMPPMGTNLAGLNGEFLEEHMNY
FT                   YEQRAKGGTGLITIENACVDFPYGTNGTTQLRIDNDQYIPGFYKLTERLHKHGTCVSIQ
FT                   INHAGASAYPARLNGLQPVSASDIPSKKGGTVPRPLTVEEIYEIVNKYGDAARRAQQAG
FT                   FDAVEIHGGHSYLLCQFLSPLYNKRTDEFGGSPENRARIVKLILEKVRAEVGPFFPIVL
FT                   RFSADEFTEGGNHLEDILELLDYCQEEADILNVSAAINDNLYLQIDQMNLEDGWRSYLA
FT                   KAVKDKFNKPTITSGNIRSPKAAEKILSEGYADLLAMGRGLIAEPNWVNKVATGQEDML
FT                   RKCISCNIGCADHRISKSKPIRCTVNPDIIHEDKYKETKVTRPTNVVVIGGGTAGLEAA
FT                   CTAAEVGCNTTLIEASEQTGGLARAIANLPDKSRIADFPNYLANRAEKLTNLKVITGTK
FT                   ADTALIDTFNPDVVVNATGSKPLLPPIKGLHDVIDKEGSKVHSIFGLISNIDDFTEFSN
FT                   KKVAVIGGGAVGLDVVEYFSERGSDVTIVEMMPLLGKDLDMITRLSMMDIIEKNNVDVQ
FT                   TETALTEVAADHFKVKHDGVDAEIPFDYGFVCLGMRPERPLMEELAAYGKEKQIEIVNI
FT                   GDSAATRKILEGVREGRNILTTLEKIGSL"
     MTDYPSIFEP LTVKRMTIKN RVIMPPMGTN LAGLNGEFLE EHMNYYEQRA KGGTGLITIE        60
     NACVDFPYGT NGTTQLRIDN DQYIPGFYKL TERLHKHGTC VSIQINHAGA SAYPARLNGL       120
     QPVSASDIPS KKGGTVPRPL TVEEIYEIVN KYGDAARRAQ QAGFDAVEIH GGHSYLLCQF       180
     LSPLYNKRTD EFGGSPENRA RIVKLILEKV RAEVGPFFPI VLRFSADEFT EGGNHLEDIL       240
     ELLDYCQEEA DILNVSAAIN DNLYLQIDQM NLEDGWRSYL AKAVKDKFNK PTITSGNIRS       300
     PKAAEKILSE GYADLLAMGR GLIAEPNWVN KVATGQEDML RKCISCNIGC ADHRISKSKP       360
     IRCTVNPDII HEDKYKETKV TRPTNVVVIG GGTAGLEAAC TAAEVGCNTT LIEASEQTGG       420
     LARAIANLPD KSRIADFPNY LANRAEKLTN LKVITGTKAD TALIDTFNPD VVVNATGSKP       480
     LLPPIKGLHD VIDKEGSKVH SIFGLISNID DFTEFSNKKV AVIGGGAVGL DVVEYFSERG       540
     SDVTIVEMMP LLGKDLDMIT RLSMMDIIEK NNVDVQTETA LTEVAADHFK VKHDGVDAEI       600
     PFDYGFVCLG MRPERPLMEE LAAYGKEKQI EIVNIGDSAA TRKILEGVRE GRNILTTLEK       660
     IGSL                                                                    664
//

If you have problems or comments...

PBIL Back to PBIL home page