(data stored in ACNUC10821 zone)

EMBL: AE017262.PE516

AE017262.PE516       Location/Qualifiers
FT   CDS             540333..540926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0524"
FT                   /product="lipase/acylhydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03306"
FT                   /protein_id="AAT03306.1"
FT                   /translation="MKKLLFLGDSVTDAGRDFENDRELGHGYVKIIADQLEQEDVTVIN
FT                   RGVSANRVADLHRRIEADAISLQPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVIL
FT                   NRIKTETNAELILMEPFVLPYPEDRKEWRGDLDPKIGAVRELAAEFGATLIPLDGLMNA
FT                   LAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK"
     MKKLLFLGDS VTDAGRDFEN DRELGHGYVK IIADQLEQED VTVINRGVSA NRVADLHRRI        60
     EADAISLQPD VVTIMIGIND TWFSFSRWED TSVTAFKEVY RVILNRIKTE TNAELILMEP       120
     FVLPYPEDRK EWRGDLDPKI GAVRELAAEF GATLIPLDGL MNALAIKHGP TFLAEDGVHP       180
     TKAGHEAIAS TWLEFTK                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page