(data stored in ACNUC10821 zone)

EMBL: AE017262.PE517

AE017262.PE517       Location/Qualifiers
FT   CDS             541112..542071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0525"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03307"
FT                   /protein_id="AAT03307.1"
FT                   /translation="MQKEKAPIGLYFLLIAVMASWGFNVTMTKVLVSYFPTVTMTSFRI
FT                   FTAAITVIIILFITKKLRLPTKREFGLIFLASIFNIVIHHFFLSNGLKLTTGTNAGLIL
FT                   GSAPIVVAIFSVVFLRERIGAWRALGFLAGIFGVSLVVLSNGTGISGISLGDIDIFIAM
FT                   ASQAFSFIIIKKLAGSMDTGLMTGYMLFLGSVMLFGLSRFMEPGGMSELVAVHSWKLWL
FT                   LFVVSAVVATAFGNFVYNYAVGKIGPSRSAIFMNFNPLFSLIGALLFLGEAIKIPQLVG
FT                   FGFIIIGVLLGSGALMDLIYERKKTKVRDPEKLLEKEV"
     MQKEKAPIGL YFLLIAVMAS WGFNVTMTKV LVSYFPTVTM TSFRIFTAAI TVIIILFITK        60
     KLRLPTKREF GLIFLASIFN IVIHHFFLSN GLKLTTGTNA GLILGSAPIV VAIFSVVFLR       120
     ERIGAWRALG FLAGIFGVSL VVLSNGTGIS GISLGDIDIF IAMASQAFSF IIIKKLAGSM       180
     DTGLMTGYML FLGSVMLFGL SRFMEPGGMS ELVAVHSWKL WLLFVVSAVV ATAFGNFVYN       240
     YAVGKIGPSR SAIFMNFNPL FSLIGALLFL GEAIKIPQLV GFGFIIIGVL LGSGALMDLI       300
     YERKKTKVRD PEKLLEKEV                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page