(data stored in ACNUC10821 zone)

EMBL: AE017262.PE518

AE017262.PE518       Location/Qualifiers
FT   CDS             542146..542370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:SP1473; match to
FT                   protein family HMM PF05979"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03308"
FT                   /db_xref="GOA:Q723F3"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723F3"
FT                   /protein_id="AAT03308.1"
FT                   /translation="MKLLLKNINELAAKQKSEGLTAFEKERQAALRQEYLKKIRGTVQD
FT                   NLHHVTIIDPLGDDVTPKKLKEIQAELRG"
     MKLLLKNINE LAAKQKSEGL TAFEKERQAA LRQEYLKKIR GTVQDNLHHV TIIDPLGDDV        60
     TPKKLKEIQA ELRG                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page