(data stored in ACNUC10821 zone)

EMBL: AE017262.PE522

AE017262.PE522       Location/Qualifiers
FT   CDS             544417..546477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0530"
FT                   /product="PTS system, IIA 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03312"
FT                   /protein_id="AAT03312.1"
FT                   /translation="MYLDNRSKTLFQEVIKNPNITNKQLEVKYKLSRYQISYSFQKVNE
FT                   WLKWKNYPEVKRSKNGRFILEPELTALFSEKETRDPSVEYLPSENERANLILLMLLTAK
FT                   EELSLAHFTTKIQVSKNTILRDLKVAQKLLPKETTVTYSRASGYQLAGSEWELRKVLTQ
FT                   VVSSVKEMFRGEHYFLSYSGIEKVQLMEIRRTLEEAEAMMQIKFTYEQIELLPYLLSVM
FT                   FLRIRDRRLIDTAFHIDEKSLSDTREYHITDILLEKTGPVPEQERLFITLQLLTTNIFS
FT                   GEILTEKLTEDLEKVVLTCLDLFEKKALVSLKNKHILIEKLLLHLKPAYYRIKYQMNLE
FT                   DTLYEKFNQEFEALNFIVKEAFDPLAKFIGREIPAGEIFFISLFIGSDMIPQNDIYHKQ
FT                   KRAIVLCPSGVTFSKIMENILVKLFPEIHFYPTISVREYAFFKAEVDIVFSSIPLKDGE
FT                   NVFVVQPFMNDIEKTQLRQHVLQNLFGMGNQLTSIDKIMEVVERNADIKDPNAIRDGII
FT                   DILSANTATDENKRVKKVYLHDLITEDNIMICEDVKNYQEAIRLASQPLLLQQAITANY
FT                   VKTMIDNHKFHDPYIIIGEDIAIPHAMPNAGVNRLAMSLLVVKNGVYFSETEQVHFVIV
FT                   IAPVDKEQHIEALYQIVHLAENHQILDDLLENVTKEKVMQTINQLVIREDE"
     MYLDNRSKTL FQEVIKNPNI TNKQLEVKYK LSRYQISYSF QKVNEWLKWK NYPEVKRSKN        60
     GRFILEPELT ALFSEKETRD PSVEYLPSEN ERANLILLML LTAKEELSLA HFTTKIQVSK       120
     NTILRDLKVA QKLLPKETTV TYSRASGYQL AGSEWELRKV LTQVVSSVKE MFRGEHYFLS       180
     YSGIEKVQLM EIRRTLEEAE AMMQIKFTYE QIELLPYLLS VMFLRIRDRR LIDTAFHIDE       240
     KSLSDTREYH ITDILLEKTG PVPEQERLFI TLQLLTTNIF SGEILTEKLT EDLEKVVLTC       300
     LDLFEKKALV SLKNKHILIE KLLLHLKPAY YRIKYQMNLE DTLYEKFNQE FEALNFIVKE       360
     AFDPLAKFIG REIPAGEIFF ISLFIGSDMI PQNDIYHKQK RAIVLCPSGV TFSKIMENIL       420
     VKLFPEIHFY PTISVREYAF FKAEVDIVFS SIPLKDGENV FVVQPFMNDI EKTQLRQHVL       480
     QNLFGMGNQL TSIDKIMEVV ERNADIKDPN AIRDGIIDIL SANTATDENK RVKKVYLHDL       540
     ITEDNIMICE DVKNYQEAIR LASQPLLLQQ AITANYVKTM IDNHKFHDPY IIIGEDIAIP       600
     HAMPNAGVNR LAMSLLVVKN GVYFSETEQV HFVIVIAPVD KEQHIEALYQ IVHLAENHQI       660
     LDDLLENVTK EKVMQTINQL VIREDE                                            686
//

If you have problems or comments...

PBIL Back to PBIL home page