(data stored in ACNUC10821 zone)

EMBL: AE017262.PE527

AE017262.PE527       Location/Qualifiers
FT   CDS             548651..549697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0535"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03317"
FT                   /protein_id="AAT03317.1"
FT                   /translation="MKALKLYGKRDLRYEEADMPTIEQPDDVILKVKTVGICGSDISRY
FT                   SKLGPYVPGMVWGHEFSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCR
FT                   KLTVIGARHPGAYAEYIKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDD
FT                   VVVVGSGNIGLLAIQWAKVFGAKRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVA
FT                   AHTDGLNADLVVEAAGSPITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSEL
FT                   TVWGSWNAISAPFPGKEWQTTIHFLANKQINIEPMITHRLSLAEGPEVFERIYERNEFF
FT                   GKVLFFPE"
     MKALKLYGKR DLRYEEADMP TIEQPDDVIL KVKTVGICGS DISRYSKLGP YVPGMVWGHE        60
     FSGEVIEVGS EVTDIEIGDR AAGCPALYCG ECEYCKKGEF ARCRKLTVIG ARHPGAYAEY       120
     IKLPAENVVK IPDELDYEAA ALVEPSAVVV HGFYHTKLQA GDDVVVVGSG NIGLLAIQWA       180
     KVFGAKRVIA IDVDDKKLAL AKEVGADVVI NSLKEDPLEV VAAHTDGLNA DLVVEAAGSP       240
     ITSAQVFAYA KKGGGVVFLG IPYADVTIER FYFEKIVRSE LTVWGSWNAI SAPFPGKEWQ       300
     TTIHFLANKQ INIEPMITHR LSLAEGPEVF ERIYERNEFF GKVLFFPE                    348
//

If you have problems or comments...

PBIL Back to PBIL home page