(data stored in ACNUC10821 zone)

EMBL: AE017262.PE529

AE017262.PE529       Location/Qualifiers
FT   CDS             550021..551292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0537"
FT                   /product="putative PTS system, galactitol-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P37189; match to
FT                   protein family HMM PF03611"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03319"
FT                   /protein_id="AAT03319.1"
FT                   /translation="MDIILDFFKYIIGLGVTVMMPIIITILGVIFRKKISVAFKAGLTV
FT                   GVGFVGLGVITSLMLTTITPVTKALVENYNFKLTATDIGWGVGSSLAWGTEVVPFVFVA
FT                   IIATNILMIAFKWTKTMDVDIWNYWQPLFIASALYLTTGSMIIAILSSIINMAIIFKIA
FT                   DWTQKDVENVLGLEGISLPQIQTTGWALVGYPMNWLLGKIPGVRKINWSTEKVQSRLGI
FT                   FGEPMLMGLIIGGGLAAIAQMPLSQVLQTGVTIAASLVLIPRMVSLLMDGLTVISEAAH
FT                   EFMEKRFPGRELFIGLDSAVGIGHPFVLSLGLLMIPITLILAFILPGNKVLPLADLTAL
FT                   PFYMIFAIVPSKGNLFRGIFTGIVIVIITLYLSGAAAPLMTELAGQIGYNIPKDAVEVT
FT                   SLAVGTQWYTWIVYYGLHWFGGIL"
     MDIILDFFKY IIGLGVTVMM PIIITILGVI FRKKISVAFK AGLTVGVGFV GLGVITSLML        60
     TTITPVTKAL VENYNFKLTA TDIGWGVGSS LAWGTEVVPF VFVAIIATNI LMIAFKWTKT       120
     MDVDIWNYWQ PLFIASALYL TTGSMIIAIL SSIINMAIIF KIADWTQKDV ENVLGLEGIS       180
     LPQIQTTGWA LVGYPMNWLL GKIPGVRKIN WSTEKVQSRL GIFGEPMLMG LIIGGGLAAI       240
     AQMPLSQVLQ TGVTIAASLV LIPRMVSLLM DGLTVISEAA HEFMEKRFPG RELFIGLDSA       300
     VGIGHPFVLS LGLLMIPITL ILAFILPGNK VLPLADLTAL PFYMIFAIVP SKGNLFRGIF       360
     TGIVIVIITL YLSGAAAPLM TELAGQIGYN IPKDAVEVTS LAVGTQWYTW IVYYGLHWFG       420
     GIL                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page