(data stored in ACNUC10821 zone)

EMBL: AE017262.PE533

AE017262.PE533       Location/Qualifiers
FT   CDS             complement(554379..554738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0508; match
FT                   to protein family HMM TIGR02058"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03323"
FT                   /protein_id="AAT03323.1"
FT                   /translation="MEQILFIQTGFGVDVHGQNITKAAERAVRNAIFTNSMPGIQGLLP
FT                   DGDLQNMVVNIKLALPCDEEKLDEDTIRAIIPYGTVTIEKMAGGMMTTSGIFLEDKEDK
FT                   NDLMYIVNASVETGY"
     MEQILFIQTG FGVDVHGQNI TKAAERAVRN AIFTNSMPGI QGLLPDGDLQ NMVVNIKLAL        60
     PCDEEKLDED TIRAIIPYGT VTIEKMAGGM MTTSGIFLED KEDKNDLMYI VNASVETGY        119
//

If you have problems or comments...

PBIL Back to PBIL home page