(data stored in ACNUC10821 zone)

EMBL: AE017262.PE534

AE017262.PE534       Location/Qualifiers
FT   CDS             complement(554745..555203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0542"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03324"
FT                   /protein_id="AAT03324.1"
FT                   /translation="MNNEQNMNQQIALFYFGYKAFTETADLIIAKHSLKRLHHRILFFT
FT                   ARMPGLTINELLTFLEISKQALHQPLAELKERELLTIEQGRRDKRQRCIFLTTAGKELE
FT                   NELGAAQRKQMAEIFANSSDTDGLHFTEVMEGYAKNRPGAALIKDFKE"
     MNNEQNMNQQ IALFYFGYKA FTETADLIIA KHSLKRLHHR ILFFTARMPG LTINELLTFL        60
     EISKQALHQP LAELKERELL TIEQGRRDKR QRCIFLTTAG KELENELGAA QRKQMAEIFA       120
     NSSDTDGLHF TEVMEGYAKN RPGAALIKDF KE                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page