(data stored in ACNUC10821 zone)

EMBL: AE017262.PE535

AE017262.PE535       Location/Qualifiers
FT   CDS             555585..557414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0543"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03325"
FT                   /protein_id="AAT03325.1"
FT                   /translation="MKKALKLFLATICMFIMIYPSTAAHAEETNIVNIPDANLKTYLNG
FT                   LLKQASDAPITKTQMNTIQTVTLSGSTYTDLTGLEEAGNLVTLSLNNTNIQTLEPIKNQ
FT                   TSLTYLTVGGDNVKDSLFVDLNGLVNLQSLSISGSEVTHNVFKTFNKLPKLTYLYAQNS
FT                   MKITDISALASLPALTTLFLQFDGIDDFRPLNDFESFKNGNLKALAAFGQNTGRTNPRI
FT                   TLKSGKLDYNETNQTLYLPFSMMPKPLTSFDGTVAPFSKSTSASNTYLGFNDVALPSAR
FT                   LSITDDGITVSGVTKEEFDNLDEIEYNARYDFPTGSYPTPPSMNSYTISSGTYDQYFDI
FT                   SHTLDLTADESFDYNQYDATSEEQFLKDVHAETDDGTAVKSDFDQVVKLDVPGEYTVTL
FT                   NAENAAGLKATPVTVKVTVHEKPVITADSQISYKKESTKSVDEFLQEIHSSVTGNAVLT
FT                   SDFDKVVDLNTPGEYTVTLNAINDRGQKADPVTVVVTVTTSDGEHVNPVPPTPEVKPTP
FT                   QEETDPTIIPEPQSENSEDQVKENNAKTEEKANKTSLTTKENKVEKADKAEKTNQPKTK
FT                   ALPQTGDTNKSTLPIAGVMLSLAALLIFRKSKS"
     MKKALKLFLA TICMFIMIYP STAAHAEETN IVNIPDANLK TYLNGLLKQA SDAPITKTQM        60
     NTIQTVTLSG STYTDLTGLE EAGNLVTLSL NNTNIQTLEP IKNQTSLTYL TVGGDNVKDS       120
     LFVDLNGLVN LQSLSISGSE VTHNVFKTFN KLPKLTYLYA QNSMKITDIS ALASLPALTT       180
     LFLQFDGIDD FRPLNDFESF KNGNLKALAA FGQNTGRTNP RITLKSGKLD YNETNQTLYL       240
     PFSMMPKPLT SFDGTVAPFS KSTSASNTYL GFNDVALPSA RLSITDDGIT VSGVTKEEFD       300
     NLDEIEYNAR YDFPTGSYPT PPSMNSYTIS SGTYDQYFDI SHTLDLTADE SFDYNQYDAT       360
     SEEQFLKDVH AETDDGTAVK SDFDQVVKLD VPGEYTVTLN AENAAGLKAT PVTVKVTVHE       420
     KPVITADSQI SYKKESTKSV DEFLQEIHSS VTGNAVLTSD FDKVVDLNTP GEYTVTLNAI       480
     NDRGQKADPV TVVVTVTTSD GEHVNPVPPT PEVKPTPQEE TDPTIIPEPQ SENSEDQVKE       540
     NNAKTEEKAN KTSLTTKENK VEKADKAEKT NQPKTKALPQ TGDTNKSTLP IAGVMLSLAA       600
     LLIFRKSKS                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page