(data stored in ACNUC10821 zone)

EMBL: AE017262.PE538

AE017262.PE538       Location/Qualifiers
FT   CDS             complement(559544..560359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0546"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03328"
FT                   /protein_id="AAT03328.1"
FT                   /translation="MKKNIFKLMMALCAVLLIAGCGNSTSADKKETKETKEDGTVTFYV
FT                   VRHGKTMLNTTDRVQGWSDAVLTPAGEEVVKSAGKGLKDVDFSAAYSSDSGRAIQTANL
FT                   ILKESDKSADKEVQTDPRFREFNFGSYEGDLNENMWTDIAKSQGKTLEEWQKAGISPKD
FT                   FADSVAALDKTRVKEGENWPAEDYATIQARLKEGLTDVAKKESKNGDSNVLLVSHGLSI
FT                   GALLDTIEPGYKLPAEGIKNASVTKITYKDGKFTIGDVNDLSYVEKGSK"
     MKKNIFKLMM ALCAVLLIAG CGNSTSADKK ETKETKEDGT VTFYVVRHGK TMLNTTDRVQ        60
     GWSDAVLTPA GEEVVKSAGK GLKDVDFSAA YSSDSGRAIQ TANLILKESD KSADKEVQTD       120
     PRFREFNFGS YEGDLNENMW TDIAKSQGKT LEEWQKAGIS PKDFADSVAA LDKTRVKEGE       180
     NWPAEDYATI QARLKEGLTD VAKKESKNGD SNVLLVSHGL SIGALLDTIE PGYKLPAEGI       240
     KNASVTKITY KDGKFTIGDV NDLSYVEKGS K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page