(data stored in ACNUC10821 zone)

EMBL: AE017262.PE539

AE017262.PE539       Location/Qualifiers
FT   CDS             complement(560640..561008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0547"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06993"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03329"
FT                   /protein_id="AAT03329.1"
FT                   /translation="MAILAFILTFIVMIEHIYIMILEMFFANTKLAAKTFGVEKELLAN
FT                   KKVQTLFANQGLYNGFLAAGLVWGLFFAGAGFAETVQIFFLSCVVVAALFGGATSSKGI
FT                   LVKQGLPAVLALVAVLLV"
     MAILAFILTF IVMIEHIYIM ILEMFFANTK LAAKTFGVEK ELLANKKVQT LFANQGLYNG        60
     FLAAGLVWGL FFAGAGFAET VQIFFLSCVV VAALFGGATS SKGILVKQGL PAVLALVAVL       120
     LV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page