(data stored in ACNUC10821 zone)

EMBL: AE017262.PE544

AE017262.PE544       Location/Qualifiers
FT   CDS             566116..566559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0524"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03334"
FT                   /protein_id="AAT03334.1"
FT                   /translation="MYSNRKEKVVFTLIMCSLMILCMSSYNIFLENGIGTDSLLIVLKA
FT                   FVPFLFIGFLLDFFVVGKIVYRLHALLVSEDASKFKKIIMMQLLMVTFMCVLMSTLSLI
FT                   VNQGEWSHLGILILRNYFVALFLQIFIVSPFVRLISPRIFALL"
     MYSNRKEKVV FTLIMCSLMI LCMSSYNIFL ENGIGTDSLL IVLKAFVPFL FIGFLLDFFV        60
     VGKIVYRLHA LLVSEDASKF KKIIMMQLLM VTFMCVLMST LSLIVNQGEW SHLGILILRN       120
     YFVALFLQIF IVSPFVRLIS PRIFALL                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page