(data stored in ACNUC10821 zone)

EMBL: AE017262.PE547

AE017262.PE547       Location/Qualifiers
FT   CDS             complement(568406..569146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0555"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by similarity to SP:P32184; match to
FT                   protein family HMM PF00376; match to protein family HMM
FT                   PF07739"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03337"
FT                   /protein_id="AAT03337.1"
FT                   /translation="MQIKELAELTGVSVRTLHHYDKIGLLVPQKDDWNGYRIYSENDID
FT                   KLQQILFFKELDFPLKKIKQILDDPFFDKNVALDLQRHLLIEKKQRIETMLATLDQTIR
FT                   NEKGEITMTNKEKFTGFDFSTNPYEEEAKKRWGDKVVEKANEKVNNMNEKEKLTLKESF
FT                   DAEFRHLASVRELSPESEEAQLAIDHFFHYLNNTHGNIYSLEAFAGLGEMYVADERFTK
FT                   NIDQFGDGLSHFLKEAMNIYAKNK"
     MQIKELAELT GVSVRTLHHY DKIGLLVPQK DDWNGYRIYS ENDIDKLQQI LFFKELDFPL        60
     KKIKQILDDP FFDKNVALDL QRHLLIEKKQ RIETMLATLD QTIRNEKGEI TMTNKEKFTG       120
     FDFSTNPYEE EAKKRWGDKV VEKANEKVNN MNEKEKLTLK ESFDAEFRHL ASVRELSPES       180
     EEAQLAIDHF FHYLNNTHGN IYSLEAFAGL GEMYVADERF TKNIDQFGDG LSHFLKEAMN       240
     IYAKNK                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page