(data stored in ACNUC10821 zone)

EMBL: AE017262.PE548

AE017262.PE548       Location/Qualifiers
FT   CDS             569376..570851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0556"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03338"
FT                   /protein_id="AAT03338.1"
FT                   /translation="MIGKVKSISMWLWHHLTPQIFAVICVFIITLIALFVPPYIGMADN
FT                   GDFFRIFSSNGLFVNNTNYDALQFGHFVKEFGIYQYFNENQVAIYSSQSIFIQMALLLN
FT                   KLFWSTTVFDVRFLGGLQLALLLPAIYLLVAGLTAKMKGWPGYVVAALTVFIFADTAYT
FT                   AYFNSFFSEGLILIMMLYISAGFLLLYQHKYNDYAMLGLIFVASLILITAKQQNAPIAV
FT                   VIAVCGILVFFIRKNRAFRISAAATFFVIFLSGVVMYAFIPGEFVTINQYQTMTRGVLL
FT                   DSENPEKSLEEMGMNSEFALLKGTNFYQKYKMIDLDSKLMEKEFYPNYNFVTVLSYYLE
FT                   NPKQFGKMLDLSAQNSFSIRPFEMGNFEKATGYKFKEKTHFFSIYSDVKEKFAPAKFTF
FT                   LILWALVFLICYGVSAFKHFREKNIRGMLLFDLVVLLIGSGFAVILVTIVGDGEADLTK
FT                   HNFLFNVCFDLTMLIGAASLLEVYMKKRGERNA"
     MIGKVKSISM WLWHHLTPQI FAVICVFIIT LIALFVPPYI GMADNGDFFR IFSSNGLFVN        60
     NTNYDALQFG HFVKEFGIYQ YFNENQVAIY SSQSIFIQMA LLLNKLFWST TVFDVRFLGG       120
     LQLALLLPAI YLLVAGLTAK MKGWPGYVVA ALTVFIFADT AYTAYFNSFF SEGLILIMML       180
     YISAGFLLLY QHKYNDYAML GLIFVASLIL ITAKQQNAPI AVVIAVCGIL VFFIRKNRAF       240
     RISAAATFFV IFLSGVVMYA FIPGEFVTIN QYQTMTRGVL LDSENPEKSL EEMGMNSEFA       300
     LLKGTNFYQK YKMIDLDSKL MEKEFYPNYN FVTVLSYYLE NPKQFGKMLD LSAQNSFSIR       360
     PFEMGNFEKA TGYKFKEKTH FFSIYSDVKE KFAPAKFTFL ILWALVFLIC YGVSAFKHFR       420
     EKNIRGMLLF DLVVLLIGSG FAVILVTIVG DGEADLTKHN FLFNVCFDLT MLIGAASLLE       480
     VYMKKRGERN A                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page